PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00658.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 196aa    MW: 21837.5 Da    PI: 9.3512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00658.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-141460148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  + +WT+eEd  l + v++ G+  W+ Ia+ ++ gR++k+c++rw ++l
  Zmw_sc00658.1.g00320.1.am.mk 14 KTPWTAEEDAALRREVRRRGPQKWAVIAAALP-GRSAKSCRLRWCQHL 60
                                  579*****************************.***********9986 PP

2Myb_DNA-binding50.74.1e-1668109346
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   ++T+eEd ++v+  + +G++ W+tIar++  gR+++ +k+rw++
  Zmw_sc00658.1.g00320.1.am.mk  68 PFTPEEDARIVEQQRVHGNK-WATIARYLR-GRSDNAVKNRWNS 109
                                   79******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.595964IPR017930Myb domain
SuperFamilySSF466895.03E-2912107IPR009057Homeodomain-like
SMARTSM007171.4E-131362IPR001005SANT/Myb domain
PfamPF002497.7E-141460IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-211667IPR009057Homeodomain-like
CDDcd001671.84E-121660No hitNo description
SMARTSM007171.3E-1265113IPR001005SANT/Myb domain
PROSITE profilePS5129419.37367115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-1968113IPR009057Homeodomain-like
CDDcd001672.07E-1068108No hitNo description
PfamPF002492.7E-1368109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MAAEGGEGMA DFKKTPWTAE EDAALRREVR RRGPQKWAVI AAALPGRSAK SCRLRWCQHL  60
APELDCRPFT PEEDARIVEQ QRVHGNKWAT IARYLRGRSD NAVKNRWNSA LRRLQVQGGG  120
RDHATEGAEA DDQQPPAPVY LELFPVRGGG LREATTSGRL AVREEQDDHV PSTSLTLGSQ  180
RWSEAELALR LGPVRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3081131106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974756.14e-77PREDICTED: myb-related protein B-like
SwissprotQ9FDW15e-41MYB44_ARATH; Transcription factor MYB44
TrEMBLK3YND55e-77K3YND5_SETIT; Uncharacterized protein
STRINGSi015776m1e-76(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465